PDB entry 2ds9

View 2ds9 on RCSB PDB site
Description: Structure of the complex of C-terminal lobe of bovine lactoferrin with mannose at 2.8 A resolution
Class: metal binding protein
Keywords: lactoferrin, complex
Deposited on 2006-06-22, released 2006-07-04
The last revision prior to the SCOP 1.75 freeze date was dated 2006-07-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactotransferrin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24627 (0-344)
      • see remark 999 (223)
      • see remark 999 (266)
    Domains in SCOP 1.75: d2ds9a1
  • Heterogens: NAG, MAN, ZN, FE, CO3, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ds9A (A:)
    ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
    agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
    drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
    kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
    teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
    ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ds9A (A:)
    ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
    agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
    drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
    kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
    teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
    ndnteclaklggrptyeeylgteyvtaianlkkcsleacaf