PDB entry 2ds8

View 2ds8 on RCSB PDB site
Description: Structure of the ZBD-XB complex
Class: metal binding protein, protein binding
Keywords: Protein-peptide complex, METAL BINDING PROTEIN, PROTEIN BINDING
Deposited on 2006-06-22, released 2007-02-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.201
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ATP-dependent Clp protease ATP-binding subunit clpX
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6H1 (Start-50)
  Domains in SCOPe 2.02: d2ds8a_
• Chain 'B':
  Compound: ATP-dependent Clp protease ATP-binding subunit clpX
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6H1
  Domains in SCOPe 2.02: d2ds8b_
• Chain 'P':
  Compound: SspB-tail peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2DS8 (Start-7)
• Chain 'Q':
  Compound: SspB-tail peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 2DS8 (Start-7)
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2ds8A (A:)
  tdkrkdgsgkllycsfcgksqhevrkliagpsvyicdecvdlcndiireei
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ds8A (A:)
  gkllycsfcgksqhevrkliagpsvyicdecvdlcndiireei
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2ds8B (B:)
  tdkrkdgsgkllycsfcgksqhevrkliagpsvyicdecvdlcndiireei
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ds8B (B:)
  kllycsfcgksqhevrkliagpsvyicdecvdlcndiiree
  

  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.