PDB entry 2ds7

View 2ds7 on RCSB PDB site
Description: Structure of the ZBD in the hexagonal crystal form
Class: metal binding protein, protein binding
Keywords: C43M mutant, zinc binding domain of ClpX, selenomethionine incorporation, METAL BINDING PROTEIN, PROTEIN BINDING
Deposited on 2006-06-22, released 2007-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.235
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ATP-dependent Clp protease ATP-binding subunit clpX
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6H1 (Start-50)
    • engineered (42)
  Domains in SCOPe 2.08: d2ds7a_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2ds7A (A:)
  tdkrkdgsgkllycsfcgksqhevrkliagpsvyicdecvdlmndiireei
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2ds7A (A:)
  lycsfcgksqhevrkliagpsvyicdecvdlmndiireei