PDB entry 2ds6

View 2ds6 on RCSB PDB site
Description: Structure of the ZBD in the tetragonal crystal form
Class: metal binding protein, protein binding
Keywords: substrate binding domain, zinc finger domain, METAL BINDING PROTEIN, PROTEIN BINDING
Deposited on 2006-06-22, released 2007-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.264
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease ATP-binding subunit clpX
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ds6a_
  • Chain 'B':
    Compound: ATP-dependent Clp protease ATP-binding subunit clpX
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ds6b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ds6A (A:)
tdkrkdgsgkllycsfcgksqhevrkliagpsvyicdecvdlcndiireei

    Sequence, based on observed residues (ATOM records): (download) 
    >2ds6A (A:)
kllycsfcgksqhevrkliagpsvyicdecvdlcndiireei

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2ds6B (B:)
tdkrkdgsgkllycsfcgksqhevrkliagpsvyicdecvdlcndiireei

    Sequence, based on observed residues (ATOM records): (download) 
    >2ds6B (B:)
llycsfcgksqhevrkliagpsvyicdecvdlcndiireei