PDB entry 2ds5

View 2ds5 on RCSB PDB site
Description: Structure of the ZBD in the orthorhomibic crystal from
Class: metal binding protein, protein binding
Keywords: treble cleft zinc finger, METAL BINDING PROTEIN, PROTEIN BINDING
Deposited on 2006-06-22, released 2007-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.185
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease ATP-binding subunit clpX
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ds5a_
  • Chain 'B':
    Compound: ATP-dependent Clp protease ATP-binding subunit clpX
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ds5b_
  • Heterogens: ZN, CA, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2ds5A (A:)
tdkrkdgsgkllycsfcgksqhevrkliagpsvyicdecvdlcndiireei

    Sequence, based on observed residues (ATOM records): (download) 
    >2ds5A (A:)
gkllycsfcgksqhevrkliagpsvyicdecvdlcndiireei

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2ds5B (B:)
tdkrkdgsgkllycsfcgksqhevrkliagpsvyicdecvdlcndiireei

    Sequence, based on observed residues (ATOM records): (download) 
    >2ds5B (B:)
sgkllycsfcgksqhevrkliagpsvyicdecvdlcndiireei