PDB entry 2ds5
View 2ds5 on RCSB PDB site
Description: Structure of the ZBD in the orthorhomibic crystal from
Class: metal binding protein, protein binding
Keywords: treble cleft zinc finger
Deposited on
2006-06-22, released
2007-02-13
The last revision prior to the SCOP 1.73 freeze date was dated
2007-02-13, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.185
AEROSPACI score: 0.63
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ATP-dependent Clp protease ATP-binding subunit clpX
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2ds5a1 - Chain 'B':
Compound: ATP-dependent Clp protease ATP-binding subunit clpX
Species: Escherichia coli
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d2ds5b1 - Heterogens: ZN, CA, PG4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2ds5A (A:)
tdkrkdgsgkllycsfcgksqhevrkliagpsvyicdecvdlcndiireei
Sequence, based on observed residues (ATOM records): (download)
>2ds5A (A:)
gkllycsfcgksqhevrkliagpsvyicdecvdlcndiireei
- Chain 'B':
Sequence, based on SEQRES records: (download)
>2ds5B (B:)
tdkrkdgsgkllycsfcgksqhevrkliagpsvyicdecvdlcndiireei
Sequence, based on observed residues (ATOM records): (download)
>2ds5B (B:)
sgkllycsfcgksqhevrkliagpsvyicdecvdlcndiireei