PDB entry 2ds4

View 2ds4 on RCSB PDB site
Description: Solution structure of the filamin domain from human tripartite motif protein 45
Class: protein binding
Keywords: beta-sandwich, immunoglobulin-like fold, filamin domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2006-06-21, released 2006-12-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tripartite motif protein 45
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM45
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H8W5 (7-112)
      • cloning artifact (0-6)
      • variant see remark 999 (107)
    Domains in SCOPe 2.05: d2ds4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ds4A (A:)
    gssgssgevdpakcvlqgedlhrarekqtasftllckdaageimgrggdnvqvavvpkdk
    kdspvrtmvqdnkdgtyyisytpkepgvytvwvcikeqhvqgspftvtvrrkh