PDB entry 2ds1

View 2ds1 on RCSB PDB site
Description: Human cyclin dependent kinase 2 complexed with the CDK4 inhibitor
Class: transferase
Keywords: protein kinase, cell cycle, inhibition, TRANSFERASE
Deposited on 2006-06-17, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (0-297)
      • engineered (81-82)
      • engineered (88)
    Domains in SCOPe 2.08: d2ds1a_
  • Heterogens: 1CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ds1A (A:)
    menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
    pnivklldvihtenklylvfehvhqdlktfmdasaltgiplpliksylfqllqglafchs
    hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
    stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
    pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ds1A (A:)
    menfqkvekigegtygvvykarnkltgevvalkkivpstaireisllkelnhpnivklld
    vihtenklylvfehvhqdlktfmdasaltgiplpliksylfqllqglafchshrvlhrdl
    kpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyystavdiws
    lgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsfpkwarqdf
    skvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl