PDB entry 2drs

View 2drs on RCSB PDB site
Description: Crystal structure of reducing-end-xylose releasing exo-oligoxylanase D263S mutant
Class: hydrolase
Keywords: (ALPLA/ALPHA)6 BARREL, GLYCOSIDE HYDROLASE FAMILY 8, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, HYDROLASE
Deposited on 2006-06-12, released 2006-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.144
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xylanase Y
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH2105
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KB30
      • engineered (262)
    Domains in SCOPe 2.08: d2drsa_
  • Heterogens: NI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2drsA (A:)
    mekttegafytreyrnlfkefgyseaeiqervkdtweqlfgdnpetkiyyevgddlgyll
    dtgnldvrtegmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtk
    nswgpapdgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnr
    dnklikfipevefsdpsyhlphfyelfslwaneedrvfwkeaaeasreylkiachpetgl
    apeyayydgtpndekgyghffsssyrvaanigldaewfggsewsaeeinkiqaffadkep
    edyrrykidgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryy
    dnclylfamlalsgnfkiwfpegqeeehlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2drsA (A:)
    kttegafytreyrnlfkefgyseaeiqervkdtweqlfgdnpetkiyyevgddlgylldt
    gnldvrtegmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtkns
    wgpapdgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnrdn
    klikfipevefsdpsyhlphfyelfslwaneedrvfwkeaaeasreylkiachpetglap
    eyayydgtpndekgyghffsssyrvaanigldaewfggsewsaeeinkiqaffadkeped
    yrrykidgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryydn
    clylfamlalsgnfkiwfp