PDB entry 2drc

View 2drc on RCSB PDB site
Description: investigation of the functional role of tryptophan-22 in escherichia coli dihydrofolate reductase by site-directed mutagenesis
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1992-06-10, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.161
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • conflict (21)
      • conflict (36)
    Domains in SCOPe 2.06: d2drca_
  • Chain 'B':
    Compound: dihydrofolate reductase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABQ4 (0-158)
      • conflict (21)
      • conflict (36)
    Domains in SCOPe 2.06: d2drcb_
  • Heterogens: CL, CA, MTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2drcA (A:)
misliaalavdrvigmenampfnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2drcB (B:)
misliaalavdrvigmenampfnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr