PDB entry 2dra

View 2dra on RCSB PDB site
Description: Complex structure of CCA-adding enzyme with tRNAminiDCC and ATP
Class: transferase/RNA
Keywords: protein-rna complex, TRANSFERASE/RNA COMPLEX
Deposited on 2006-06-08, released 2006-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CCA-adding enzyme
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2draa1, d2draa2, d2draa3
  • Chain 'B':
    Compound: tRNA (34-MER)
  • Heterogens: MG, SO4, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2draA (A:)
    mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
    dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
    kniksavdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcelliv
    fygsfletvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvh
    lcrefmeapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlera
    srkifeflerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkfls
    rnrafrpfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgekl
    fkepvtaelcemmgvkd
    

  • Chain 'B':
    No sequence available.