PDB entry 2dr8

View 2dr8 on RCSB PDB site
Description: Complex structure of CCA-adding enzyme with tRNAminiDC and CTP
Class: transferase/RNA
Keywords: protein-rna complex
Deposited on 2006-06-08, released 2006-11-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CCA-adding enzyme
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dr8a1, d2dr8a2, d2dr8a3
  • Chain 'B':
    Compound: tRNA (33-MER)
  • Heterogens: SO4, MG, CTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dr8A (A:)
    mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
    dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
    kniksavdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcelliv
    fygsfletvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvh
    lcrefmeapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlera
    srkifeflerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkfls
    rnrafrpfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgekl
    fkepvtaelcemmgvkd
    

  • Chain 'B':
    No sequence available.