PDB entry 2dr1

View 2dr1 on RCSB PDB site
Description: Crystal structure of the PH1308 protein from Pyrococcus horikoshii OT3
Class: Transferase
Keywords: aminotransferase, PLP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transferase
Deposited on 2006-06-05, released 2006-12-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.18
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 386aa long hypothetical serine aminotransferase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2dr1a_
  • Chain 'B':
    Compound: 386aa long hypothetical serine aminotransferase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2dr1b_
  • Heterogens: NA, CL, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dr1A (A:)
    meimefeeafkevyemvkpkyklftagpvacfpevleimkvqmfshrskeyrkvhmdtve
    rlreflevekgevllvpssgtgimeasirngvskggkvlvtiigafgkrykevvesngrk
    avvleyepgkavkpedlddalrknpdveavtitynetstgvlnplpelakvakehdklvf
    vdavsamggadikfdkwgldvvfsssqkafgvppglaigafserfleiaekmpergwyfd
    iplyvkylkekestpstppmpqvfginvalriiekmggkekwlemyekrakmvregvrei
    gldilaepghesptitavltppgikgdevyeamrkrgfelakgygsvkektfrighmgym
    kfediqemldnlrevinelkkqkgin
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dr1A (A:)
    efeeafkevyemvkpkyklftagpvacfpevleimkvqmfshrskeyrkvhmdtverlre
    flevekgevllvpssgtgimeasirngvskggkvlvtiigafgkrykevvesngrkavvl
    eyepgkavkpedlddalrknpdveavtitynetstgvlnplpelakvakehdklvfvdav
    samggadikfdkwgldvvfsssqkafgvppglaigafserfleiaekmpergwyfdiply
    vkylkekestpstppmpqvfginvalriiekmggkekwlemyekrakmvregvreigldi
    laepghesptitavltppgikgdevyeamrkrgfelakgygsvkektfrighmgymkfed
    iqemldnlrevinelkkqkgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dr1B (B:)
    meimefeeafkevyemvkpkyklftagpvacfpevleimkvqmfshrskeyrkvhmdtve
    rlreflevekgevllvpssgtgimeasirngvskggkvlvtiigafgkrykevvesngrk
    avvleyepgkavkpedlddalrknpdveavtitynetstgvlnplpelakvakehdklvf
    vdavsamggadikfdkwgldvvfsssqkafgvppglaigafserfleiaekmpergwyfd
    iplyvkylkekestpstppmpqvfginvalriiekmggkekwlemyekrakmvregvrei
    gldilaepghesptitavltppgikgdevyeamrkrgfelakgygsvkektfrighmgym
    kfediqemldnlrevinelkkqkgin
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dr1B (B:)
    evyemvkpkyklftagpvacfpevleimkvqmfshrskeyrkvhmdtverlreflevekg
    evllvpssgtgimeasirngvskggkvlvtiigafgkrykevvesngrkavvleyepgka
    vkpedlddalrknpdveavtitynetstgvlnplpelakvakehdklvfvdavsamggad
    ikfdkwgldvvfsssqkafgvppglaigafserfleiaekmpergwyfdiplyvkylkek
    estpstppmpqvfginvalriiekmggkekwlemyekrakmvregvreigldilaepghe
    sptitavltppgikgdevyeamrkrgfelakgygsvkektfrighmgymkfediqemldn
    lrevinelkkqkgi