PDB entry 2dqz

View 2dqz on RCSB PDB site
Description: Crystal structure of human carboxylesterase in complex with homatropine, coenzyme A, and palmitate
Class: hydrolase
Keywords: cholesterol, esterase, HYDROLASE
Deposited on 2006-06-02, released 2006-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Liver carboxylesterase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dqza_
  • Chain 'B':
    Compound: Liver carboxylesterase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dqzb_
  • Chain 'C':
    Compound: Liver carboxylesterase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dqzc_
  • Heterogens: NAG, SIA, SO4, F, PLM, HTQ, COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dqzA (A:)
    hpssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvk
    natsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvw
    ihggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaal
    rwvqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkk
    gdvkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpl
    lgtvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktam
    sllwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrd
    agaptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkf
    wanfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfakkavekp
    pq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dqzA (A:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dqzB (B:)
    hpssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvk
    natsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvw
    ihggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaal
    rwvqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkk
    gdvkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpl
    lgtvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktam
    sllwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrd
    agaptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkf
    wanfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfakkavekp
    pq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dqzB (B:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dqzC (C:)
    hpssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvk
    natsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvw
    ihggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaal
    rwvqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkk
    gdvkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpl
    lgtvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktam
    sllwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrd
    agaptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkf
    wanfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfakkavekp
    pq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dqzC (C:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak