PDB entry 2dqy

View 2dqy on RCSB PDB site
Description: Crystal structure of human carboxylesterase in complex with cholate and palmitate
Class: hydrolase
Keywords: cholesterol metabolism, foam cells, macrophage, monocyte, atherosclerosis, HYDROLASE
Deposited on 2006-06-02, released 2006-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.226
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Liver carboxylesterase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dqya_
  • Chain 'B':
    Compound: Liver carboxylesterase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dqyb_
  • Chain 'C':
    Compound: Liver carboxylesterase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dqyc_
  • Heterogens: NAG, SIA, SO4, CHD, PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dqyA (A:)
    hpssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvk
    natsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvw
    ihggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaal
    rwvqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkk
    gdvkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpl
    lgtvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktam
    sllwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrd
    agaptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkf
    wanfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfakkavekp
    pq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dqyA (A:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dqyB (B:)
    hpssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvk
    natsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvw
    ihggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaal
    rwvqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkk
    gdvkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpl
    lgtvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktam
    sllwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrd
    agaptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkf
    wanfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfakkavekp
    pq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dqyB (B:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dqyC (C:)
    hpssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvk
    natsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvw
    ihggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaal
    rwvqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkk
    gdvkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpl
    lgtvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktam
    sllwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrd
    agaptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkf
    wanfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfakkavekp
    pq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dqyC (C:)
    ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
    tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
    ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
    vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
    vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
    tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
    lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
    aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
    nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak