PDB entry 2dqt

View 2dqt on RCSB PDB site
Description: High resolution crystal structure of the complex of the hydrolytic antibody Fab 6D9 and a transition-state analog
Class: immune system
Keywords: catalytic antibody, ester hydrolysis, esterolytic, fab, immunoglobulin, immune system
Deposited on 2006-05-30, released 2006-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin 6d9
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2DQT (Start-223)
    Domains in SCOPe 2.07: d2dqth1
  • Chain 'L':
    Compound: immunoglobulin 6d9
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2DQT (0-218)
    Domains in SCOPe 2.07: d2dqtl1, d2dqtl2
  • Heterogens: CPD, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2dqtH (H:)
    evklvesggglvkpggslklscaasgftfsnyamswvrqtpekrlewvvsissggsiyyl
    dsvkgrftvsrdnarnilylqmtslrsedtamyfcarvshydgsrdwyfdvwgagtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dqtH (H:)
    vklvesggglvkpggslklscaasgftfsnyamswvrqtpekrlewvvsissggsiyyld
    svkgrftvsrdnarnilylqmtslrsedtamyfcarvshydgsrdwyfdvwgagtsvtvs
    sakttppsvyplapgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dqtL (L:)
    dvlmtqtplslpvslgdqasiscrssqtivhsngdtyldwflqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec