PDB entry 2dqr

View 2dqr on RCSB PDB site
Description: Crystal structure of the replication terminator protein mutant RTP.E39K.R42Q
Class: DNA binding protein
Keywords: DNA replication, winged-helix, RTP, DNA BINDING PROTEIN
Deposited on 2006-05-29, released 2007-05-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.205
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication termination protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rtp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68732 (Start-121)
      • engineered (38)
      • engineered (41)
    Domains in SCOPe 2.06: d2dqra_
  • Chain 'B':
    Compound: Replication termination protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rtp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68732 (Start-121)
      • engineered (38)
      • engineered (41)
    Domains in SCOPe 2.06: d2dqrb_
  • Chain 'C':
    Compound: Replication termination protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rtp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68732 (Start-121)
      • engineered (38)
      • engineered (41)
    Domains in SCOPe 2.06: d2dqrc_
  • Chain 'D':
    Compound: Replication termination protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rtp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68732 (Start-121)
      • engineered (38)
      • engineered (41)
    Domains in SCOPe 2.06: d2dqrd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dqrA (A:)
    mkeekrsstgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrs
    lhellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsd
    nf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dqrA (A:)
    rsstgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrslhell
    ddgilkqievvlyqfkdyeaaklykkqlkveldrckkliekalsdnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dqrB (B:)
    mkeekrsstgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrs
    lhellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsd
    nf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dqrB (B:)
    stgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrslhelldd
    gilkqikvkkegqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dqrC (C:)
    mkeekrsstgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrs
    lhellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsd
    nf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dqrC (C:)
    flvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrslhellddgil
    kqikvkqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dqrD (D:)
    mkeekrsstgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrs
    lhellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrckkliekalsd
    nf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dqrD (D:)
    stgflvkqraflklymitmteqerlyglkllkvlqsefkeigfkpnhtevyrslhelldd
    gilkqikvkqevvlyqfkdyeaaklykkqlkveldrckkliekalsdnf