PDB entry 2dq5

View 2dq5 on RCSB PDB site
Description: solution structure of the Mid1 B Box2 Chc(D/C)C2H2 Zinc-Binding Domain: insights into an evolutionary conserved ring fold
Class: ligase
Keywords: E3 Ligase, RING like, Zinc coordination
Deposited on 2006-05-20, released 2007-04-03
The last revision prior to the SCOP 1.75 freeze date was dated 2007-05-29, with a file datestamp of 2007-06-04.
Experiment type: NMR16
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Midline-1
    Species: HOMO SAPIENS
    Gene: MID1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2dq5a1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dq5A (A:)
    shirglmclehedekvnmycvtddqlicalcklvgrhrdhqvaalse