PDB entry 2dpu

View 2dpu on RCSB PDB site
Description: Crystal structure of the replication termination protein in complex with a pseudosymmetric 21mer B-site DNA
Class: DNA binding protein/DNA
Keywords: protein-DNA complex, winged-helix, DNA replication, DNA BINDING PROTEIN/DNA COMPLEX
Deposited on 2006-05-15, released 2007-05-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.206
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replication termination protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: rtp
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68732 (Start-121)
      • engineered (109)
    Domains in SCOPe 2.02: d2dpua1
  • Chain 'D':
    Compound: 5'-d(p*ap*tp*gp*tp*tp*cp*ap*tp*ap*g)-3'
  • Chain 'E':
    Compound: 5'-d(*cp*tp*ap*tp*gp*ap*ap*cp*ap*tp*t)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dpuA (A:)
    mkeekrsstgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrs
    lhellddgilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsd
    nf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dpuA (A:)
    stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd
    gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.