PDB entry 2dpp

View 2dpp on RCSB PDB site
Description: Crystal structure of thermostable Bacillus sp. RAPc8 nitrile hydratase
Class: lyase
Keywords: nitrile hydratase, cobalt, oxidised cys, LYASE
Deposited on 2006-05-12, released 2007-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: 0.202
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrile hydratase alpha subunit
    Species: Bacillus sp. RAPc8 [TaxId:218609]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84FS5
      • modified residue (118)
      • modified residue (120)
    Domains in SCOPe 2.07: d2dppa_
  • Chain 'B':
    Compound: Nitrile hydratase beta subunit
    Species: Bacillus sp. RAPc8 [TaxId:218609]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dppb_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dppA (A:)
    mtidqkntnidprfphhhprpqsfwearakaleslliekghlssdaiervikhyehelgp
    mngakvvakawtdpafkqrlledsetvlrelgyyglqgehirvventdtvhnvvvctlcs
    cypwpllglppswykepayrarvvkeprqvlkefgldlpdsveirvwdssseirfmvlpq
    rpegtegmteeelaklvtrdsmigvakieppkvtvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dppA (A:)
    idprfphhhprpqsfwearakaleslliekghlssdaiervikhyehelgpmngakvvak
    awtdpafkqrlledsetvlrelgyyglqgehirvventdtvhnvvvctlcscypwpllgl
    ppswykepayrarvvkeprqvlkefgldlpdsveirvwdssseirfmvlpqrpegtegmt
    eeelaklvtrdsmigvakiepp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dppB (B:)
    mngihdvggmdgfgkvmyvkeeediyfthdwerlafglvagcmaqglgmkafdefrigie
    lmrpvdyltssyyghwiatvaynlvdtgvldekeldertevflkkpdtkiprredpalvk
    lvekalydglsplreisasprfkvgeriktknihptghtrfpryardkygvidevygahv
    fpddaahrkgenpqylyrvrfeaeelwgykqkdsvyidlwesymepvsh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dppB (B:)
    mngihdvggmdgfgkvmyvkeeediyfthdwerlafglvagcmaqglgmkafdefrigie
    lmrpvdyltssyyghwiatvaynlvdtgvldekeldertevflkkpdtkiprredpalvk
    lvekalydglsplreisasprfkvgeriktknihptghtrfpryardkygvidevygahv
    fpddaahrkgenpqylyrvrfeaeelwgykqkdsvyidlwesymepv