PDB entry 2dpm

View 2dpm on RCSB PDB site
Description: dpnm DNA adenine methyltransferase from streptoccocus pneumoniae complexed with s-adenosylmethionine
Class: transferase
Keywords: DNA adenine methyltransferase, methyltransferase, methylase, DNA methyltransferase group alpha, s-adenosylmethionine, DNA n6-adenine methylation, dpnii restriction-modification system, gatc methylation, rossmann fold, transferase
Deposited on 1998-09-03, released 1998-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (adenine-specific methyltransferase dpnii 1)
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: DPNM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dpma_
  • Heterogens: HG, SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dpmA (A:)
    mkikeikkvtlqpftkwtggkrqllpvirelipktynryfepfvgggalffdlapkdavi
    ndfnaelincyqqikdnpqelieilkvhqeynskeyyldlrsadrderidmmsevqraar
    ilymlrvnfnglyrvnsknqfnvpygryknpkivdeelisaisvyinnnqleikvgdfek
    aivdvrtgdfvyfdppyiplsetsaftsythegfsfadqvrlrdafkrlsdtgayvmlsn
    sssalveelykdfnihyveatrtngaksssrgkiseiivtnyek
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dpmA (A:)
    tlqpftkwtggkrqllpvirelipktynryfepfvgggalffdlapkdavindfnaelin
    cyqqikdnpqelieilkvhqeynskeyyldlrsadrderidmmsevqraarilymlrvnf
    nglyrvnsknqfnvpygryknpkivdeelisaisvyinnnqleikvgdfekaivdvrtgd
    fvyfdppyiplftsythegfsfadqvrlrdafkrlsdtgayvmlsnsssalveelykdfn
    ihyvegkiseiivtnyek