PDB entry 2dp9

View 2dp9 on RCSB PDB site
Description: Crystal Structure of Conserved Hypothetical Protein TTHA0113 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: jellyroll, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-05-08, released 2006-11-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein TTHA0113
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SM30 (3-123)
    • cloning artifact (0-2)
  Domains in SCOPe 2.03: d2dp9a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dp9A (A:)
  mdymerpklglivrepyaslivdgrkvweirrrktrhrgplgivsggrligqadlvgveg
  pfsveellahqekhlaeeaflrayakdeplyawvlenafryekplhvprrpgrvmfvdls
  evrw