PDB entry 2dp5

View 2dp5 on RCSB PDB site
Description: Structure of streptococcus pyogenes bacteriophage-associated hyaluronate lyase Hylp2
Class: lyase
Keywords: lyase, hyaluronan lyase, phage tail fibre, triple-stranded beta-helix, hyaluronidase
Deposited on 2006-05-06, released 2006-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.55 Å
R-factor: 0.223
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hyaluronidase
    Species: Streptococcus pyogenes [TaxId:1314]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dp5a1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dp5A (A:)
    lrvqfkrmkaaewarsdvilleseigfetdtgfaragdghnrfsdlgyispldynlltnk
    pnidglatkvetaqklqqkadketvytkaeskqeldkklnlkggvmtgqlkfkpaatvay
    ssstggavnidlsstrgagvvvysdndtsdgplmslrtgketfnqsalfvdykgttnavn
    iamrhattpnfssalnitsgnengsamqlrgsekalgtlkithenpsigadydknaaalp
    ldlskrqngagtaaqgiyinstsgttgkllrirnlsddkfyvksdggfyaketsqidgnl
    klkdptandhaatkayvdkaiselkklilkkh