PDB entry 2dp3

View 2dp3 on RCSB PDB site
Description: Crystal structure of a double mutant (C202A/A198V) of Triosephosphate isomerase from giardia lamblia
Class: isomerase
Keywords: triosephosphate isomerase, giardia, enzyme, alpha/beta barrel, isomerase
Deposited on 2006-05-05, released 2007-01-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.175
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Giardia intestinalis [TaxId:5741]
    Gene: gltim
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36186
      • engineered (197)
      • engineered (201)
    Domains in SCOPe 2.01: d2dp3a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dp3A (A:)
    mparrpfiggnfkcngsldfikshvaaiaahkipdsvdvviapsavhlstaiaantskql
    riaaqnvylegngawtgetsvemlqdmglkhvivghserrrimgetdeqsakkakralek
    gmtvifcvgetlderkanrtmevniaqlealgkelgeskmlwkevviayepvwsigtgvv
    atpeqaeevhvglrkwfvekvaaegaqhiriiyggsangsnceklgqcpnidgflvggas
    lkpefmtmidiltktrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dp3A (A:)
    parrpfiggnfkcngsldfikshvaaiaahkipdsvdvviapsavhlstaiaantskqlr
    iaaqnvylegngawtgetsvemlqdmglkhvivghserrrimgetdeqsakkakralekg
    mtvifcvgetlderkanrtmevniaqlealgkelgeskmlwkevviayepvwsigtgvva
    tpeqaeevhvglrkwfvekvaaegaqhiriiyggsangsnceklgqcpnidgflvggasl
    kpefmtmidiltktr