PDB entry 2dou

View 2dou on RCSB PDB site
Description: probable N-succinyldiaminopimelate aminotransferase (TTHA0342) from Thermus thermophilus HB8
Class: transferase
Keywords: PLP-dependent enzyme, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2006-05-03, released 2006-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable N-succinyldiaminopimelate aminotransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2doua_
  • Chain 'B':
    Compound: probable N-succinyldiaminopimelate aminotransferase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2doub_
  • Heterogens: SO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2douA (A:)
    msrvpepsvflvvdeakrkarergvglidlsigstdlpppeaplkalaealndpttygyc
    lksctlpfleeaarwyegrygvgldprrealaligsqeglahlllaltepedllllpeva
    ypsyfgaarvaslrtfliplredgladlkavpegvwreakvlllnypnnptgavadwgyf
    eealglarkhglwlihdnpyvdqvyegeapsplalpgakervvelfslsksynlagfrlg
    falgseealarlervkgvidfnqyagvlrmgvealktpkevvrgyarvyreralgmaeal
    kgvlsllppratmylwgrlpegvddlefglrlvergvalapgrgfgpggkgfvrialvrp
    leelleaakrireald
    

    Sequence, based on observed residues (ATOM records): (download)
    >2douA (A:)
    vpepsvflvvdeakrkarergvglidlsigstdlpppeaplkalaealndpttygyclks
    ctlpfleeaarwyegrygvgldprrealaligsqeglahlllaltepedllllpevayps
    yfgaarvaslrtfliplredgladlkavpegvwreakvlllnypnnptgavadwgyfeea
    lglarkhglwlihdnpyvdqvyegeapsplalpgakervvelfslsksynlagfrlgfal
    gseealarlervkgvidfnqyagvlrmgvealktpkevvrgyarvyreralgmaealkgv
    lsllppratmylwgrlpegvddlefglrlvergvalapgrgfgpggkgfvrialvrplee
    lleaakrireal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2douB (B:)
    msrvpepsvflvvdeakrkarergvglidlsigstdlpppeaplkalaealndpttygyc
    lksctlpfleeaarwyegrygvgldprrealaligsqeglahlllaltepedllllpeva
    ypsyfgaarvaslrtfliplredgladlkavpegvwreakvlllnypnnptgavadwgyf
    eealglarkhglwlihdnpyvdqvyegeapsplalpgakervvelfslsksynlagfrlg
    falgseealarlervkgvidfnqyagvlrmgvealktpkevvrgyarvyreralgmaeal
    kgvlsllppratmylwgrlpegvddlefglrlvergvalapgrgfgpggkgfvrialvrp
    leelleaakrireald
    

    Sequence, based on observed residues (ATOM records): (download)
    >2douB (B:)
    svflvvdeakrkarergvglidlsigstdlpppeaplkalaealndpttygyclksctlp
    fleeaarwyegrygvgldprrealaligsqeglahlllaltepedllllpevaypsyfga
    arvaslrtfliplredgladlkavpegvwreakvlllnypnnptgavadwgyfeealgla
    rkhglwlihdnpyvdqvyegeapsplalpgakervvelfslsksynlagfrlgfalgsee
    alarlervkgvidfnqyagvlrmgvealktpkevvrgyarvyreralgmaealkgvlsll
    ppratmylwgrlpegvddlefglrlvergvalapgrgfgpggkgfvrialvrpleellea
    akrireal