PDB entry 2doh

View 2doh on RCSB PDB site
Description: The X-ray crystallographic structure of the angiogenesis inhibitor, angiostatin, bound a to a peptide from the group A streptococcal surface protein PAM
Class: hydrolase
Keywords: lysine-binding site, plasminogen, kringle domains, HYDROLASE
Deposited on 2006-04-29, released 2006-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: Plasminogen-binding group A streptococcal M-like protein PAM
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2DOH
  • Chain 'X':
    Compound: angiostatin
    Species: Homo sapiens [TaxId:9606]
    Gene: PLG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dohx1, d2dohx2
  • Heterogens: DIO, HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download) 
    >2dohX (X:)
lsecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndp
qgpwcyttdpekrydycdileceeecmhcsgenydgkisktmsglecqawdsqsphahgy
ipskfpnknlkknycrnpdrelrpwcfttdpnkrwelcdiprcttpppssgptyqclkgt
genyrgnvavtvsghtcqhwsaqtphthertpenfpcknldenycrnpdgkrap

    Sequence, based on observed residues (ATOM records): (download) 
    >2dohX (X:)
lsecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndp
qgpwcyttdpekrydycdileceeecmhcsgenydgkisktmsglecqawdsqsphahgy
ipskfpnknlkknycrnpdrelrpwcfttdpnkrwelcdiprctt