PDB entry 2dof

View 2dof on RCSB PDB site
Description: Solution structure of the fourth FF domain of human transcription factor CA150
Class: transcription
Keywords: FF domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2006-04-28, released 2006-10-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription elongation regulator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: TCERG1, CA150, TAF2S
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14776 (7-78)
      • cloning artifact (0-6)
      • cloning artifact (79-84)
    Domains in SCOPe 2.06: d2dofa1, d2dofa2, d2dofa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dofA (A:)
    gssgssgdrereqhkreeaiqnfkallsdmvrssdvswsdtrrtlrkdhrwesgsllere
    ekeklfnehiealtkkkresgpssg