PDB entry 2do4

View 2do4 on RCSB PDB site
Description: Solution structure of the RNA binding domain of squamous cell carcinoma antigen recognized by T cells 3
Class: immune system
Keywords: RRM domaim, RDB, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, IMMUNE SYSTEM
Deposited on 2006-04-27, released 2007-04-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Squamous cell carcinoma antigen recognized by T-cells 3
  Species: Homo sapiens [TaxId:9606]
  Gene: SART3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15020 (7-93)
    • cloning artifact (0-6)
    • cloning artifact (94-99)
  Domains in SCOPe 2.05: d2do4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2do4A (A:)
  gssgssgvfrystslekhklfisglpfsctkeeleeickahgtvkdlrlvtnragkpkgl
  ayveyenesqasqavmkmdgmtikeniikvaisnsgpssg