PDB entry 2do3

View 2do3 on RCSB PDB site
Description: Solution structure of the third KOW motif of transcription elongation factor SPT5
Class: transcription
Keywords: KOW motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2006-04-27, released 2006-10-27
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcription elongation factor SPT5
  Species: Homo sapiens [TaxId:9606]
  Gene: SUPT5H
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00267 (7-68)
    • cloning artifact (0-6)
  Domains in SCOPe 2.01: d2do3a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2do3A (A:)
  gssgssgefpaqelrkyfkmgdhvkviagrfegdtglivrveenfvilfsdltmhelkvl
  prdlqlcse