PDB entry 2do3

View 2do3 on RCSB PDB site
Description: Solution structure of the third KOW motif of transcription elongation factor SPT5
Class: transcription
Keywords: KOW motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-04-27, released 2006-10-27
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-27, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcription elongation factor SPT5
  Species: HOMO SAPIENS
  Gene: SUPT5H
  Database cross-references and differences (RAF-indexed):
  • Uniprot O00267 (7-68)
    • cloning artifact (0-6)
  Domains in SCOP 1.75: d2do3a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2do3A (A:)
  gssgssgefpaqelrkyfkmgdhvkviagrfegdtglivrveenfvilfsdltmhelkvl
  prdlqlcse