PDB entry 2do1

View 2do1 on RCSB PDB site
Description: Solution structure of the SAP domain of human nuclear protein Hcc-1
Class: gene regulation
Keywords: SAP domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-04-27, released 2006-10-27
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-27, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear protein Hcc-1
    Species: HOMO SAPIENS
    Gene: HCC1, HSPC316
    Database cross-references and differences (RAF-indexed):
    • Uniprot P82979 (7-48)
      • cloning artiact (0-6)
      • cloning artiact (49-54)
    Domains in SCOP 1.73: d2do1a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2do1A (A:)
    gssgssgvelhklklaelkqeclargletkgikqdlihrlqayleehaesgpssg