PDB entry 2dnz

View 2dnz on RCSB PDB site
Description: Solution structure of the second RNA binding domain of RNA binding motif protein 23
Class: RNA binding protein
Keywords: RNA recognition motif, RRM, RNA binding domain, RBD, RNP, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA binding protein
Deposited on 2006-04-27, released 2007-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable RNA-binding protein 23
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM23
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86U06 (7-88)
      • cloning artifact (0-6)
      • cloning artifact (89-94)
    Domains in SCOPe 2.07: d2dnza1, d2dnza2, d2dnza3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dnzA (A:)
    gssgssglyvgslhfnitedmlrgifepfgkidnivlmkdsdtgrskgygfitfsdseca
    rraleqlngfelagrpmrvghvterldggsgpssg