PDB entry 2dnv

View 2dnv on RCSB PDB site
Description: Solution Structure of RSGI RUH-055, a Chromo Domain from Mus musculus cDNA
Class: transcription
Keywords: Chromo domain, Histone H3 tail, Choromatin organization modifier, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2006-04-26, released 2006-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromobox protein homolog 8
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9QXV1 (7-57)
      • cloning artifact (0-6)
      • cloning artifact (58-63)
    Domains in SCOPe 2.08: d2dnva1, d2dnva2, d2dnva3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dnvA (A:)
    gssgssgervfaaeallkrrirkgrmeylvkwkgwsqkystwepeenildarllaafesg
    pssg