PDB entry 2dnu

View 2dnu on RCSB PDB site
Description: Solution structure of RSGI RUH-061, a SH3 domain from human
Class: structural genomics, structural protein
Keywords: SH3, RSGI, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, STRUCTURAL PROTEIN
Deposited on 2006-04-26, released 2006-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 multiple domains 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TDQ8 (7-64)
      • cloning artifact (0-6)
      • cloning artifact (65-70)
    Domains in SCOPe 2.08: d2dnua1, d2dnua2, d2dnua3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dnuA (A:)
    gssgssgeekyvtvqpytsqskdeigfekgvtvevirknlegwwyirylgkegwapasyl
    kkakdsgpssg