PDB entry 2dnk

View 2dnk on RCSB PDB site
Description: Solution structure of RNA binding domain in Bruno-like 4 RNA binding protein
Class: RNA binding protein
Keywords: RRM domain,RBD,Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-04-26, released 2006-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bruno-like 4, RNA binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BRUNOL4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BQ96 (7-98)
      • cloning artifact (0-6)
      • cloning artifact (99-104)
    Domains in SCOPe 2.08: d2dnka1, d2dnka2, d2dnka3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dnkA (A:)
gssgssgclrqppshrklfvgmlnkqqseddvrrlfeafgnieectilrgpdgnskgcaf
vkysshaeaqaainalhgsqtmpgassslvvkfadtdkesgpssg