PDB entry 2dnj

View 2dnj on RCSB PDB site
Description: dnase i-induced dna conformation. 2 angstroms structure of a dnase i- octamer complex
Deposited on 1986-10-21, released 1994-01-31
The last revision prior to the SCOP 1.57 freeze date was dated 1995-01-15, with a file datestamp of 1995-01-19.
Experiment type: -
Resolution: 2 Å
R-factor: 0.174
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d2dnja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dnjA (A:)
    lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
    ntyhyvvseplgrnsykerylflfrpnkvsvldtyqyddgcescgndsfsrepavvkfss
    hstkvkefaivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssq
    wssirlrtsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayg
    lsnemalaisdhypvevtlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dnjA (A:)
    lkiaafnirtfgetkmsnatlasyivrivrrydivliqevrdshlvavgklldylnqddp
    ntyhyvvseplgrnsykerylflfrpnkvsvldtyqydddsfsrepavvkfsshstkvke
    faivalhsapsdavaeinslydvyldvqqkwhlndvmlmgdfnadcsyvtssqwssirlr
    tsstfqwlipdsadttatstncaydrivvagsllqssvvpgsaapfdfqaayglsnemal
    aisdhypvevtlt