PDB entry 2dna

View 2dna on RCSB PDB site
Description: Solution Structure of RSGI RUH-056, a UBA domain from mouse cDNA
Class: structural genomics, unknown function
Keywords: Ubiquitin associated domain, Dsk2 protein, Proteasome, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-04-25, released 2006-10-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unnamed protein product
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14DR8 (7-60)
      • cloning artifact (0-6)
      • cloning artifact (61-66)
    Domains in SCOPe 2.03: d2dnaa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dnaA (A:)
    gssgssgpshslqapevrfskemeclqamgfvnynanlqaliatdgdtnaaiyklkssqg
    fsgpssg