PDB entry 2dna

View 2dna on RCSB PDB site
Description: Solution Structure of RSGI RUH-056, a UBA domain from mouse cDNA
Class: structural genomics, unknown function
Keywords: Ubiquitin associated domain, Dsk2 protein, Proteasome, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-04-25, released 2006-10-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-25, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unnamed protein product
    Species: MUS MUSCULUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14DR8 (7-60)
      • cloning artifact (0-6)
      • cloning artifact (61-66)
    Domains in SCOP 1.73: d2dnaa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dnaA (A:)
    gssgssgpshslqapevrfskemeclqamgfvnynanlqaliatdgdtnaaiyklkssqg
    fsgpssg