PDB entry 2dna

View 2dna on RCSB PDB site
Description: Solution Structure of RSGI RUH-056, a UBA domain from mouse cDNA
Class: structural genomics, unknown function
Keywords: Ubiquitin associated domain, Dsk2 protein, Proteasome, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-04-25, released 2006-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: unnamed protein product
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14DR8 (7-60)
    • cloning artifact (0-6)
    • cloning artifact (61-66)
  Domains in SCOPe 2.08: d2dnaa1, d2dnaa2, d2dnaa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dnaA (A:)
  gssgssgpshslqapevrfskemeclqamgfvnynanlqaliatdgdtnaaiyklkssqg
  fsgpssg