PDB entry 2dn7

View 2dn7 on RCSB PDB site
Description: Solution structures of the 6th fn3 domain of human receptor-type tyrosine-protein phosphatase F
Class: signaling protein, hydrolase
Keywords: LAR protein, Leukocyte antigen related, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN, HYDROLASE
Deposited on 2006-04-25, released 2006-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor-type tyrosine-protein phosphatase F
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPRF, LAR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10586 (7-100)
      • cloning artifact (0-6)
      • cloning artifact (101-106)
    Domains in SCOPe 2.08: d2dn7a1, d2dn7a2, d2dn7a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dn7A (A:)
    gssgssgpgrptmmisttamntallqwhppkelpgellgyrlqycradearpntidfgkd
    dqhftvtglhkgttyifrlaaknraglgeefekeirtpedlsgpssg