PDB entry 2dn6

View 2dn6 on RCSB PDB site
Description: Solution structure of the PH domain of KIAA0640 protein from human
Class: signaling protein
Keywords: PH domain, KIAA0640 protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-25, released 2006-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: KIAA0640 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KIAA0640
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UH65 (7-108)
    • cloning artifact (0-6)
    • cloning artifact (109-114)
  Domains in SCOPe 2.08: d2dn6a1, d2dn6a2, d2dn6a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dn6A (A:)
  gssgssgvlkqgymmkkghrrknwterwfvlkpniisyyvsedlkdkkgdilldenccve
  slpdkdgkkclflvkcfdktfeisasdkkkkqewiqaihstihllklgssgpssg