PDB entry 2dn5

View 2dn5 on RCSB PDB site
Description: Solution Structure of RSGI RUH-057, a GTF2I domain in human cDNA
Class: transcription
Keywords: Transcription factor, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-04-25, released 2006-10-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: General transcription factor II-I repeat domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NP005676
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHL9 (7-82)
      • cloning artifact (0-6)
      • cloning artifact (83-88)
    Domains in SCOPe 2.08: d2dn5a1, d2dn5a2, d2dn5a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dn5A (A:)
    gssgssglreqvkelfnekygealglnrpvlvpyklirdspdavevtglpddipfrnpnt
    ydihrlekilkarehvrmviinqsgpssg