PDB entry 2dmy

View 2dmy on RCSB PDB site
Description: Solution structure of DSRM domain in Spermatid perinuclear RNA-bind protein
Class: RNA binding protein
Keywords: NMR, DSRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-04-24, released 2006-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Spermatid perinuclear RNA-binding protein
  Species: Homo sapiens [TaxId:9606]
  Gene: STRBP
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H7V1 (7-90)
    • cloning artifact (0-6)
    • cloning artifact (91-96)
  Domains in SCOPe 2.08: d2dmya1, d2dmya2, d2dmya3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dmyA (A:)
  gssgssgrkildskaidlmnalmrlnqirpglqykllsqsgpvhapvftmsvdvdgttye
  asgpskktaklhvavkvlqamgyptgfdadisgpssg