PDB entry 2dms

View 2dms on RCSB PDB site
Description: Solution structure of the homeobox domain of Homeobox protein OTX2
Class: DNA binding protein
Keywords: homeobox domain, three helices with the DNA binding helix-turn-helix motif, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2006-04-24, released 2006-10-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein OTX2
    Species: Mus musculus [TaxId:10090]
    Gene: Otx2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80206 (7-73)
      • cloning artifact (0-6)
      • cloning artifact (74-79)
    Domains in SCOPe 2.08: d2dmsa1, d2dmsa2, d2dmsa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dmsA (A:)
    gssgssgrrerttftraqldvlealfaktrypdifmreevalkinlpesrvqvwfknrra
    kcrqqqqqqqnggqsgpssg