PDB entry 2dmo

View 2dmo on RCSB PDB site
Description: Refined solution structure of the 1st SH3 domain from human Neutrophil cytosol factor 2 (NCF-2)
Class: signaling protein
Keywords: SH3 domain, Neutrophil Cytosol factor, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-22, released 2006-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: neutrophil cytosol factor 2
  Species: Homo sapiens [TaxId:9606]
  Gene: NCF2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19878 (7-61)
    • cloning artifact (0-6)
    • cloning artifact (62-67)
  Domains in SCOPe 2.08: d2dmoa1, d2dmoa2, d2dmoa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dmoA (A:)
  gssgssgeahrvlfgfvpetkeelqvmpgnivfvlkkgndnwatvmfngqkglvpcnyle
  pvsgpssg