PDB entry 2dmd

View 2dmd on RCSB PDB site
Description: Solution structure of the N-terminal C2H2 type zinc-binding domain of the Zinc finger protein 64, isoforms 1 and 2
Class: transcription
Keywords: Zinc finger protein 338, ZNF338, Nuclear protein, DNA-binding, Transcription, C2H2-type zinc finger, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-04-21, released 2006-10-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-21, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Zinc finger protein 64, isoforms 1 and 2
  Species: HOMO SAPIENS
  Gene: ZFP64
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NPA5 (7-89)
    • cloning artifact (0-6)
    • cloning artifact (90-95)
  Domains in SCOP 1.73: d2dmda1, d2dmda2, d2dmda3
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dmdA (A:)
  gssgssgphkcevcgkcfsrkdklkthmrchtgvkpykcktcdyaaadssslnkhlrihs
  derpfkcqicpyasrnssqltvhlrshtgdsgpssg