PDB entry 2dmb

View 2dmb on RCSB PDB site
Description: Solution structure of the 15th Filamin domain from human Filamin-B
Class: structural protein
Keywords: beta-sandwich, immunoglobulin-like fold, filamin domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-04-20, released 2006-10-20
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-20, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Filamin-B
  Species: HOMO SAPIENS
  Gene: FLNB
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75369 (7-117)
    • cloning artifact (0-6)
    • cloning artifact (118-123)
  Domains in SCOP 1.73: d2dmba1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dmbA (A:)
  gssgssgtgdaskclatgpgiastvktgeevgfvvdaktagkgkvtctvltpdgteaead
  vienedgtydifytaakpgtyviyvrfggvdipnspftvmatdgevtaveeapvnacpsg
  pssg