PDB entry 2dma

View 2dma on RCSB PDB site
Description: Crystal Structure of PH1978 from Pyrococcus horikoshii OT3 (form II)
Class: hydrolase
Keywords: A-ATpase, Structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, HYDROLASE
Deposited on 2006-04-20, released 2007-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.224
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: V-type ATP synthase subunit E
    Species: Pyrococcus horikoshii [TaxId:70601]
    Gene: atpE
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57724 (Start-197)
      • modified residue (96)
      • modified residue (124)
      • modified residue (158)
      • modified residue (180)
    Domains in SCOPe 2.07: d2dmaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dmaA (A:)
    mngaeliiqeinkeaerkieyilnearqqaekikeearrnaeakaewiirraktqaelek
    qriianarlevrrkrlaiqeeiissvleevkrrletmsedeyfesvkallkeaikelnek
    kvrvmsnektlgliasrieeikselgdvsielgetvdtmggvivetedgriridntfear
    merfegeirstiakvlfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dmaA (A:)
    eiissvleevkrrletmsedeyfesvkallkeaikelnekkvrvmsnektlgliasriee
    ikselgdvsielgetvdtmggvivetedgriridntfearmerfegeirstiakvlfg