PDB entry 2dm7

View 2dm7 on RCSB PDB site
Description: Solution structure of the 14th Ig-like domain of human KIAA1556 protein
Class: contractile protein
Keywords: beta-sandwich, ig-fold, Obscurin, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CONTRACTILE PROTEIN
Deposited on 2006-04-20, released 2006-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1556 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA1556
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NHN3 (7-101)
      • cloning artifact (0-6)
      • cloning artifact (102-107)
    Domains in SCOPe 2.06: d2dm7a1, d2dm7a2, d2dm7a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dm7A (A:)
    gssgssgparftqdlktkeasegatatlqcelskvapvewkkgpetlrdggryslkqdgt
    rcelqihdlsvadageyscmcgqertsatltvralparftegsgpssg