PDB entry 2dm6

View 2dm6 on RCSB PDB site
Description: Crystal structure of anti-configuration of indomethacin and leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase complex
Class: oxidoreductase
Keywords: NAD(P)-binding Rossmann-fold domains, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, OXIDOREDUCTASE
Deposited on 2006-04-20, released 2006-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADP-dependent leukotriene B4 12-hydroxydehydrogenase
    Species: Cavia porcellus [TaxId:10141]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EQZ5 (4-332)
      • cloning artifact (2-3)
    Domains in SCOPe 2.07: d2dm6a1, d2dm6a2, d2dm6a3
  • Chain 'B':
    Compound: NADP-dependent leukotriene B4 12-hydroxydehydrogenase
    Species: Cavia porcellus [TaxId:10141]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9EQZ5 (4-332)
      • cloning artifact (0-3)
    Domains in SCOPe 2.07: d2dm6b1, d2dm6b2, d2dm6b3
  • Heterogens: NAP, IMN, TAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dm6A (A:)
    spefmvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskr
    lkegavmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdklpls
    lalgtigmpgltayfgllevcgvkggetvlvsaaagavgsvvgqiaklkgckvvgaagsd
    ekiaylkqigfdaafnyktvnsleealkkaspdgydcyfdnvggeflntvlsqmkdfgki
    aicgaisvynrmdqlppgpspesiiykqlriegfivyrwqgdvrekalrdlmkwvlegki
    qyhehvtkgfenmpaafiemlnganlgkavvta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dm6A (A:)
    efmvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskrlk
    egavmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdklplsla
    lgtigmpgltayfgllevcgvkggetvlvsaaagavgsvvgqiaklkgckvvgaagsdek
    iaylkqigfdaafnyktvnsleealkkaspdgydcyfdnvggeflntvlsqmkdfgkiai
    cgaisvynrmdqlppgpspesiiykqlriegfivyrwqgdvrekalrdlmkwvlegkiqy
    hehvtkgfenmpaafiemlnganlgkavvta
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dm6B (B:)
    spefmvkakswtlkkhfqgkptqsdfelktvelpplkngevllealflsvdpymriaskr
    lkegavmmgqqvarvvesknsafpagsivlaqsgwtthfisdgkgleklltewpdklpls
    lalgtigmpgltayfgllevcgvkggetvlvsaaagavgsvvgqiaklkgckvvgaagsd
    ekiaylkqigfdaafnyktvnsleealkkaspdgydcyfdnvggeflntvlsqmkdfgki
    aicgaisvynrmdqlppgpspesiiykqlriegfivyrwqgdvrekalrdlmkwvlegki
    qyhehvtkgfenmpaafiemlnganlgkavvta